H00653687-B01P hCG_1731871 antibody

See related secondary antibodies

Search for all "hCG_1731871"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human hCG_1731871

H00653687-B01P

Product Description for hCG_1731871

Mouse anti Human hCG_1731871.
Product is tested for Western blot / Immunoblot.

Properties for hCG_1731871

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LOC653687
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
hCG_1731871 (ABM85753.1, 1 a.a. ~ 99 a.a) full-length human protein.
AA Sequence:
MLKYVIKRYRSFLPEIFKKASDLPELVFGFYLKELDPAEHSYVLIRKIDPALVWGLTGDQGTPKTRLLMITLDSIF MQASCVPEEVVWEVLRVLEAHFV
GeneID:
653687
Add. information Mouse polyclonal antibody raised against a full-length human hCG_1731871 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn