discontinued

H00003055-B01P HCK antibody

See related secondary antibodies

Search for all "HCK"

Quick Overview

Mouse anti Human HCK

Product Description for HCK

Mouse anti Human HCK.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for HCK

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms B-cell/myeloid kinase, BMK, Hemopoietic cell kinase, Tyrosine-protein kinase HCK, p56-HCK, p59-HCK, p60-HCK
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P08631
Immunogen:
HCK (ENSP00000365012, 1 a.a. ~ 505 a.a) full-length human protein.
AA Sequence:
MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDL SFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDS ETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKP WEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVT KEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFG LARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMP RPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
GeneID:
3055
Remarks:
Gene Accession: ENST00000375852
Add. information Mouse polyclonal antibody raised against a full-length human HCK protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3055

Accessory Products

Proteins and/or Positive Controls

Proteins for HCK (9 products)

Catalog No. Species Pres. Purity   Source  

HCK

HCK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

Positive controls for HCK (3 products)

Catalog No. Species Pres. Purity   Source  

HCK 293T Cell Transient Overexpression Lysate(Denatured)

HCK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn