discontinued

H00003055-M02 HCK antibody

See related secondary antibodies

Search for all "HCK"

Quick Overview

Mouse anti Human HCK 2A6

H00003055-M02

More Views

  • H00003055-M02

Product Description for HCK

Mouse anti Human HCK 2A6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for HCK

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms B-cell/myeloid kinase, BMK, Hemopoietic cell kinase, Tyrosine-protein kinase HCK, p56-HCK, p59-HCK, p60-HCK
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2A6
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P08631
Immunogen:
HCK (AAH14435, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDL SFQK
GeneID:
3055
Remarks:
Gene Accession: BC014435
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant HCK.

Antibody Reactive Against Recombinant Protein.
Application ELISA,PLA-Ce,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3055

Accessory Products

Proteins and/or Positive Controls

Proteins for HCK (9 products)

Catalog No. Species Pres. Purity   Source  

HCK

HCK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

HCK

HCK Human
  Abnova Taiwan Corp.

Positive controls for HCK (3 products)

Catalog No. Species Pres. Purity   Source  

HCK 293T Cell Transient Overexpression Lysate(Denatured)

HCK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn