TA343135 HCK antibody

Rabbit Polyclonal Anti-HCK Antibody

See related secondary antibodies

Search for all "HCK"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HCK

Product Description for HCK

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat HCK.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HCK

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms B-cell/myeloid kinase, BMK, Hemopoietic cell kinase, Tyrosine-protein kinase HCK, p56-HCK, p59-HCK, p60-HCK
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-HCK antibody is: synthetic peptide directed towards the C-terminal region of Human HCK. Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA.
Application WB
Background The protein encoded by this gene is a member of the Src family of tyrosine kises. This protein is primarily hemopoietic, particularly in cells of the myeloid and B-lymphoid lineages. It may help couple the Fc receptor to the activation of the respiratory burst. In addition, it may play a role in neutrophil migration and in the degranulation of neutrophils. Multiple isoforms with different subcellular distributions are produced due to both altertive splicing and the use of altertive translation initiation codons, including a non-AUG (CUG) codon.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 894% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for HCK (9 products)

Catalog No. Species Pres. Purity   Source  


HCK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HCK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HCK Human
  Abnova Taiwan Corp.


HCK Human
  Abnova Taiwan Corp.


HCK Human
  Abnova Taiwan Corp.


HCK Human
  Abnova Taiwan Corp.

Positive controls for HCK (3 products)

Catalog No. Species Pres. Purity   Source  

HCK 293T Cell Transient Overexpression Lysate(Denatured)

HCK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HCK overexpression lysate

HCK overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn