TA344256 HDDC2 antibody

Rabbit Polyclonal Anti-HDDC2 Antibody - N-terminal region

See related secondary antibodies

Search for all "HDDC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HDDC2

Product Description for HDDC2

Rabbit anti Human HDDC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HDDC2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms C6orf74, CGI-130, HCV NS5A-transactivated protein 2, HD domain-containing protein 2, Hepatitis C virus NS5A-transactivated protein 2, NS5ATP2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-HDDC2 antibody is: synthetic peptide directed towards the N-terminal region of Human HDDC2. Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for HDDC2 (5 products)

Catalog No. Species Pres. Purity   Source  


HDDC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HDDC2 (1-204, His-tag)

HDDC2 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

HDDC2 (1-204, His-tag)

HDDC2 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH


HDDC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


HDDC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HDDC2 (2 products)

Catalog No. Species Pres. Purity   Source  

HDDC2 overexpression lysate

HDDC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HD domain containing 2 Lysate

Western Blot: HD domain containing 2 Lysate [NBL1-11487] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HDDC2
  Novus Biologicals Inc.
  • LinkedIn