discontinued

NBP1-55081 HECTD2 antibody

See related secondary antibodies

Search for all "HECTD2"

Quick Overview

Rabbit anti Human, Mouse HECTD2

Product Description for HECTD2

Rabbit anti Human, Mouse HECTD2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HECTD2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ16050
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RD78
Immunogen:
Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET.
GeneID:
100172010
Background HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 100172010

Accessory Products

  • LinkedIn