NBP1-55081 HECTD2 antibody

See related secondary antibodies

Search for all "HECTD2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse HECTD2

Product Description for HECTD2

Rabbit anti Human, Mouse HECTD2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HECTD2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms FLJ16050
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET.
Background HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100172010

Accessory Products

  • LinkedIn