discontinued

H00064399-D01P Hedgehog-interacting protein / HHIP antibody

See related secondary antibodies

Search for all "Hedgehog-interacting protein / HHIP"

Quick Overview

Rabbit anti Human Hedgehog-interacting protein / HHIP

Product Description for Hedgehog-interacting protein / HHIP

Rabbit anti Human Hedgehog-interacting protein / HHIP.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Hedgehog-interacting protein / HHIP

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms HIP
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QV1
Immunogen:
HHIP (NP_071920.1, 1 a.a. ~ 700 a.a) full-length human protein.
AA Sequence:
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRL SCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTC RGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQ PVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYT TNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDME EMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSN GKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQE KPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSEC SRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQ IIDMTSYLLDLTSYIV
GeneID:
64399
Remarks:
Gene Accession: NM_022475.1
Add. information Rabbit polyclonal antibody raised against a full-length human HHIP protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 64399

Accessory Products

Proteins and/or Positive Controls

Proteins for Hedgehog-interacting protein / HHIP (2 products)

Catalog No. Species Pres. Purity   Source  

Hedgehog-interacting protein / HHIP

Hedgehog-interacting protein / HHIP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Hedgehog-interacting protein / HHIP

Hedgehog-interacting protein / HHIP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn