discontinued

H00064399-M01 Hedgehog-interacting protein / HHIP antibody

See related secondary antibodies

Search for all "Hedgehog-interacting protein / HHIP"

Quick Overview

Mouse anti Human Hedgehog-interacting protein / HHIP 5D11

H00064399-M01

More Views

  • H00064399-M01
  • H00064399-M01
  • H00064399-M01
  • H00064399-M01

Product Description for Hedgehog-interacting protein / HHIP

Mouse anti Human Hedgehog-interacting protein / HHIP 5D11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for Hedgehog-interacting protein / HHIP

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms HIP
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 5D11
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96QV1
Immunogen:
HHIP (NP_071920, 21 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFS VTNNTECGKLLEEIKCALCSPHSQ*
GeneID:
64399
Remarks:
Gene Accession: NM_022475
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant HHIP.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 64399

Accessory Products

Proteins and/or Positive Controls

Proteins for Hedgehog-interacting protein / HHIP (2 products)

Catalog No. Species Pres. Purity   Source  

Hedgehog-interacting protein / HHIP

Hedgehog-interacting protein / HHIP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Hedgehog-interacting protein / HHIP

Hedgehog-interacting protein / HHIP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn