discontinued

H00009931-M04 HELZ / DRHC antibody

See related secondary antibodies

Search for all "HELZ / DRHC"

Quick Overview

Mouse anti Human HELZ / DRHC 1C11

Product Description for HELZ / DRHC

Mouse anti Human HELZ / DRHC 1C11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for HELZ / DRHC

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Down-regulated in human cancers protein, KIAA0054, Probable helicase with zinc finger domain
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1C11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P42694
Immunogen:
HELZ (NP_055692, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQA DEDCRHVLGEGLAKGEDAFRAVLC*
GeneID:
9931
Remarks:
Gene Accession: NM_014877
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant HELZ.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for HELZ / DRHC (2 products)

Catalog No. Species Pres. Purity   Source  

HELZ / DRHC

HELZ / DRHC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HELZ / DRHC

HELZ / DRHC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn