
NBP1-56486 HEMK2 antibody

See related secondary antibodies

Search for all "HEMK2"

50 µg / €440.00

Quick Overview

Rabbit anti Human HEMK2

Product Description for HEMK2

Rabbit anti Human HEMK2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HEMK2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C21orf127, HEMK2, MGC19995, MTQ2, N6AMT, PRED28
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to N6AMT1(N-6 adenine-specific DNA methyltransferase 1 (putative)) The peptide sequence was selected from the N terminal of N6AMT1. Peptide sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL.
Background The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn