H00641654-B01P HEPN1 antibody

See related secondary antibodies

Search for all "HEPN1"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human HEPN1

H00641654-B01P

Product Description for HEPN1

Mouse anti Human HEPN1.
Product is tested for Western blot / Immunoblot.

Properties for HEPN1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6WQI6
Immunogen:
HEPN1 (AAI56584.1, 1 a.a. ~ 88 a.a) full-length human protein.
AA Sequence:
MGNWGLGIAPWVDGESELEFRRLGMQGPLEALRRREWNTQRASFSFSFLIALSPHTVDYCHSYELFNRRWHGHVLA TQRPSLFILMLV
GeneID:
641654
Add. information Mouse polyclonal antibody raised against a full-length human HEPN1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn