H00283755-B01P HERC2P3 antibody

See related secondary antibodies

Search for all "HERC2P3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human HERC2P3

H00283755-B01P

Product Description for HERC2P3

Mouse anti Human HERC2P3.
Product is tested for Western blot / Immunoblot.

Properties for HERC2P3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms D15F37S4
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BVR0
Immunogen:
HERC2P3 (AAI66678.1, 1 a.a. ~ 1158 a.a) full-length human protein.
AA Sequence:
MHAFCVGQYLEPDQEGVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIFSGGLQTS QIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPI MFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRS YKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPHWRRIAQKIIREPRKKRVPKKPESTDDEEKIGNEES DLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEK RKCLLKQLERAEVRLEGIDTILKLYLVSKNFLLPSVPYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLL EVTFGKLYAWAVQNIRNVLVDASAKFKELGIQPVPLQTITNENPSGPSLGTIPQAHFLLVMLSMLTLQHSANNLDL LLNSGTLALAQTALRLIGPSCDSVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWK WGDQDRPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGNYDLKLAELPAPAQPSAEDSDTEDDSEAEQTERN IHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLQMLVYREQHRSWCTLGFVQSIALTLQVCGTLSSLQ WITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLMEKLFDFLGSLLTMCSSDVPLLRESTL RRRRVCPQASLTATHSSTLAEEVVALLHTLHSLTQWNGLINKYINSQLRSITHSFAGRPSKGAQLEDYFPDSENPE VGGLMAVLAVVGGIDGRLCLGGQVVHDDFGEVTMTRITLKGKITVQFSDMRTCHVCPLNQLKPLPAVAFNVNNLPF TEPMLSVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALFSHQDKLRQILSQPAVQET GTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEERMSRCCFWRRRTTKLEQILLFI RRMNSVCEKENTNATASN
GeneID:
283755
Add. information Mouse polyclonal antibody raised against a full-length human HERC2P3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn