H00390992-B01P HES3 antibody

See related secondary antibodies

Search for all "HES3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human HES3

H00390992-B01P

Product Description for HES3

Mouse anti Human HES3.
Product is tested for Western blot / Immunoblot.

Properties for HES3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms bHLHb43
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TGS1
Immunogen:
HES3 (AAI56116.1, 1 a.a. ~ 186 a.a) full-length human protein.
AA Sequence:
MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGV SQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSA SVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
GeneID:
390992
Add. information Mouse polyclonal antibody raised against a full-length human HES3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for HES3 (1 products)

Catalog No. Species Pres. Purity   Source  

Hairy and enhancer of split 3 (Drosophila) (HES3)

Hairy and enhancer of split 3 (Drosophila) (HES3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for HES3 (1 products)

Catalog No. Species Pres. Purity   Source  

HES3 overexpression lysate

HES3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn