discontinued

H00023462-B02 HEY1 antibody

See related secondary antibodies

Search for all "HEY1"

Quick Overview

Mouse anti Human HEY1

Product Description for HEY1

Mouse anti Human HEY1.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for HEY1

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms BHLHB31, CHF2, Cardiovascular helix-loop-helix factor 2, Class B basic helix-loop-helix protein 31, HERP2, HES-related repressor protein 1, HESR1, HRT1, Hairy and enhancer of split-related protein 1, Hairy-related transcription factor 1, Hairy/enhancer-of-split related with YRPW motif protein 1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y5J3
Immunogen:
HEY1 (NP_036390.3, 1 a.a. ~ 304 a.a) full-length human protein.
AA Sequence:
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLV PSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRV RLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPA LRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTEIGAF
GeneID:
23462
Remarks:
Gene Accession: NM_012258.3
Add. information Mouse polyclonal antibody raised against a full-length human HEY1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 23462

Accessory Products

Proteins and/or Positive Controls

Proteins for HEY1 (7 products)

Catalog No. Species Pres. Purity   Source  

HEY1 (transcript variant 2)

HEY1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

HEY1

HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

HEY1

HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

HEY1

HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for HEY1 (4 products)

Catalog No. Species Pres. Purity   Source  

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11520] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11521] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn