HEY1

Product Description for HEY1

Mouse anti Human HEY1 1F11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Product Category	Primary Antibodies
Target Category	HEY1 antibody
Quantity	0.1 mg
Synonyms	BHLHB31, CHF2, Cardiovascular helix-loop-helix factor 2, Class B basic helix-loop-helix protein 31, HERP2, HES-related repressor protein 1, HESR1, HRT1, Hairy and enhancer of split-related protein 1, Hairy-related transcription factor 1, Hairy/enhancer-of-split related with YRPW motif protein 1
Presentation	Purified
Reactivity	Hu
Applications	E, WB
Clonality	Monoclonal
Clone	1F11
Host	Mouse
Isotype	IgG2a
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	Abnova Taiwan Corp.
Manufacturer certificates	ISO 13485:2003

Immunogen	Swiss Prot Num: Q9Y5J3 Immunogen: HEY1 (NP_036390, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AA Sequence: `DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLL PQNGHGNAGTTASPTEPHHQGRLG*` GeneID: 23462 Remarks: Gene Accession: NM_012258
Isotype control	AM03096PU-N
Add. information	Mouse monoclonal antibody raised against a partial recombinant HEY1. Antibody Reactive Against Recombinant Protein.
Application	ELISA,S-ELISA,WB-Re
Storage	In 1x PBS, pH 7.2
Format	Label: None Purification: Purified Buffer System: In 1x PBS, pH 7.2 Purity: Purified State: Purified
Specificity	Species: Human
Gene ID	23462

Catalog No.	Species	Pres.	Purity	Source
TP316696	HEY1 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
H00023462-P01-10	HEY1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00023462-P01-25	HEY1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00023462-Q01-10	HEY1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue
					Abnova Taiwan Corp.
H00023462-Q01-25	HEY1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue
					Abnova Taiwan Corp.
10-288-22161F	HEY1
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.
10-288-22161F-50	HEY1
	Human	Purified	95 %	E. coli
					GenWay Biotech Inc.

Catalog No.	Host	Pres.	Applications
R1253AP	Mouse IgG (H+L chain) antibody
	Rabbit	AP	C, E, WB
				OriGene Technologies GmbH
R1253B	Mouse IgG (H+L chain) antibody
	Rabbit	Biotin	C, E, WB
				OriGene Technologies GmbH
R1253F	Mouse IgG (H+L chain) antibody
	Rabbit	FITC	E, ICC/IF
				OriGene Technologies GmbH
R1253HRP	Mouse IgG (H+L chain) antibody
	Rabbit	HRP	C, E, WB
				OriGene Technologies GmbH
R1253TR	Mouse IgG (H+L chain) antibody
	Rabbit	Texas Red	ICC/IF
				OriGene Technologies GmbH
R1403R	Mouse IgG (H+L chain), F(ab)2 Fragment, adsorbed antibody
	Rabbit	PE	F
				OriGene Technologies GmbH
R1405R	Mouse IgG (H+L chain), F(ab)2 Fragment, adsorbed antibody
	Goat	PE
				OriGene Technologies GmbH
R1455R	Mouse IgG (H+L chain), F(ab)2 Fragment, adsorbed antibody
	Donkey	PE
				OriGene Technologies GmbH
R1457C2	Mouse IgG (H+L chain), adsorbed antibody
	Goat	Cy2
				OriGene Technologies GmbH
R1457C3	Mouse IgG (H+L chain), adsorbed antibody
	Goat	Cy3
				OriGene Technologies GmbH
R1457C5	Mouse IgG (H+L chain), adsorbed antibody
	Goat	Cy5
				OriGene Technologies GmbH