TA346067 HEY1 antibody

Rabbit Polyclonal Anti-HEY1 Antibody

See related secondary antibodies

Search for all "HEY1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HEY1

Product Description for HEY1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish HEY1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HEY1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms BHLHB31, CHF2, Cardiovascular helix-loop-helix factor 2, Class B basic helix-loop-helix protein 31, HERP2, HES-related repressor protein 1, HESR1, HRT1, Hairy and enhancer of split-related protein 1, Hairy-related transcription factor 1, Hairy/enhancer-of-split related with YRPW motif protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-HEY1 antibody: synthetic peptide directed towards the N terminal of human HEY1. Synthetic peptide located within the following region: ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG.
Application WB
Background This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptiol repressors.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for HEY1 (7 products)

Catalog No. Species Pres. Purity   Source  

HEY1 (transcript variant 2)

HEY1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


HEY1 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.


HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.


HEY1 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for HEY1 (4 products)

Catalog No. Species Pres. Purity   Source  

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11520] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 Lysate

Western Blot: HEY1 Lysate [NBL1-11521] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HEY1
  Novus Biologicals Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HEY1 overexpression lysate

HEY1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn