
NBP1-59923 HGFA Inhibitor 1 antibody

See related secondary antibodies

Search for all "HGFA Inhibitor 1"

Quick Overview

Rabbit anti Human HGFA Inhibitor 1

Product Description for HGFA Inhibitor 1

Rabbit anti Human HGFA Inhibitor 1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HGFA Inhibitor 1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SPINT1(serine peptidase inhibitor, Kunitz type 1) The peptide sequence was selected from the middle region of SPINT1. Peptide sequence PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS.
Background The protein encoded by this gene is a member of the Kunitz family of serine protease inhibitors. The protein is a potent inhibitor specific for HGF activator and is thought to be involved in the regulation of the proteolytic activation of HGF in injured t
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn