discontinued

H00007290-B01P HIRA / TUPLE1 antibody

See related secondary antibodies

Search for all "HIRA / TUPLE1"

Quick Overview

Mouse anti Human HIRA / TUPLE1

H00007290-B01P

More Views

  • H00007290-B01P

Product Description for HIRA / TUPLE1

Mouse anti Human HIRA / TUPLE1.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for HIRA / TUPLE1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DGCR1, HIR, HIR histone cell cycle regulation defective homolog A, TUP1-like enhancer of split protein 1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P54198
Immunogen:
HIRA (NP_003316.3, 1 a.a. ~ 1017 a.a) full-length human protein.
AA Sequence:
MKLLKPTWVNHNGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCV RWSNSGMYLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVD NTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRL SWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGS KDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTYG KSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQVETRTAD GRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGD SVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRDLL ESSSDSDEKVPLAKASSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLP IPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVF STCGRRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPV MNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQ ETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLK ELLPVIGQNLRFQRLFTECQEQLDILRDK
GeneID:
7290
Remarks:
Gene Accession: NM_003325.3
Add. information Mouse polyclonal antibody raised against a full-length human HIRA protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7290

Accessory Products

Proteins and/or Positive Controls

Proteins for HIRA / TUPLE1 (5 products)

Catalog No. Species Pres. Purity   Source  

HIRA / TUPLE1

HIRA / TUPLE1 Human Purified
  Abnova Taiwan Corp.

HIRA / TUPLE1

HIRA / TUPLE1 Human Purified
  Abnova Taiwan Corp.

HIRA / TUPLE1

HIRA / TUPLE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HIRA / TUPLE1

HIRA / TUPLE1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HIRA / TUPLE1

HIRA / TUPLE1 Human
  Abnova Taiwan Corp.

Positive controls for HIRA / TUPLE1 (1 products)

Catalog No. Species Pres. Purity   Source  

HIRA 293T Cell Transient Overexpression Lysate(Denatured)

HIRA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn