discontinued

NBP1-86826 HKR1 antibody

See related secondary antibodies

Search for all "HKR1"

Quick Overview

Rabbit anti Human HKR1

NBP1-86826

More Views

  • NBP1-86826

Product Description for HKR1

Rabbit anti Human HKR1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for HKR1

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Krueppel-related zinc finger protein 1
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10072
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YPEDQKQQQDPFCFSGKAEWIQEGEDSRLLFGRVSKNGTSKALSSPPEEQQPAQSKEDNTVVDIGSSPER
GeneID:
284459
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 284459

Accessory Products

Proteins and/or Positive Controls

Proteins for HKR1 (2 products)

Catalog No. Species Pres. Purity   Source  

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn