TA345615 HKR1 antibody

Rabbit Polyclonal Anti-HKR1 Antibody

See related secondary antibodies

Search for all "HKR1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat HKR1

Product Description for HKR1

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat HKR1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HKR1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Krueppel-related zinc finger protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10072
Immunogen:
The immunogen for anti-HKR1 antibody: synthetic peptide directed towards the N terminal of human HKR1. Synthetic peptide located within the following region: RDVAVYFTQEEWRLLSPAQRTLHREVMLETYNHLVSLEIPSSKPKLIAQL.
GeneID:
284459
Application WB
Background HKR1 belongs to the krueppel C2H2-type zinc-finger protein family.It may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HKR1 (2 products)

Catalog No. Species Pres. Purity   Source  

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HKR1

HKR1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn