discontinued

H00003108-M01 HLA class II DM alpha / HLA-DMA antibody

See related secondary antibodies

Search for all "HLA class II DM alpha / HLA-DMA"

Quick Overview

Mouse anti Human HLA class II DM alpha / HLA-DMA 3F12-F11

H00003108-M01

More Views

  • H00003108-M01
  • H00003108-M01

Product Description for HLA class II DM alpha / HLA-DMA

Mouse anti Human HLA class II DM alpha / HLA-DMA 3F12-F11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for HLA class II DM alpha / HLA-DMA

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DM alpha chain, DMA, HLA class II histocompatibility antigen, MHC class II antigen DMA, RING6, Really interesting new gene 6 protein
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 3F12-F11
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P28067
Immunogen:
HLA-DMA (AAH11447, 1 a.a. ~ 262 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQN TRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNL FPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLL ENVLCGVAFGLGVLGIIVGIVLIIYFR
Remarks:
Gene Accession: BC011447
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a full length recombinant HLA-DMA.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for HLA class II DM alpha / HLA-DMA (2 products)

Catalog No. Species Pres. Purity   Source  

HLA class II DM alpha / HLA-DMA

HLA class II DM alpha / HLA-DMA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HLA class II DM alpha / HLA-DMA

HLA class II DM alpha / HLA-DMA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HLA class II DM alpha / HLA-DMA (2 products)

Catalog No. Species Pres. Purity   Source  

HLA-DMA 293T Cell Transient Overexpression Lysate(Denatured)

HLA-DMA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HLA DMA Lysate

Western Blot: HLA DMA Lysate [NBL1-11591] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HLA
  Novus Biologicals Inc.
  • LinkedIn