discontinued

H00003127-B01 HLA class II DRB5 beta / HLA-DRB5 antibody

See related secondary antibodies

Search for all "HLA class II DRB5 beta / HLA-DRB5"

Quick Overview

Mouse anti Human HLA class II DRB5 beta / HLA-DRB5

Product Description for HLA class II DRB5 beta / HLA-DRB5

Mouse anti Human HLA class II DRB5 beta / HLA-DRB5.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for HLA class II DRB5 beta / HLA-DRB5

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms DR beta-5, DR2-beta-2, DRB5 beta chain, Dw2, HLA class II histocompatibility antigen, MHC class II antigen DRB5
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q30154
Immunogen:
HLA-DRB5 (AAH09234, 1 a.a. ~ 267 a.a) full-length human protein.
AA Sequence:
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEY RAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFY PGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKM LSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS*
GeneID:
3127
Remarks:
Gene Accession: BC009234
Add. information Mouse polyclonal antibody raised against a full-length human HLA-DRB5 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 3127

Accessory Products

Proteins and/or Positive Controls

Positive controls for HLA class II DRB5 beta / HLA-DRB5 (3 products)

Catalog No. Species Pres. Purity   Source  

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HLA overexpression lysate

HLA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn