discontinued

H00003127-D01P HLA class II DRB5 beta / HLA-DRB5 antibody

See related secondary antibodies

Search for all "HLA class II DRB5 beta / HLA-DRB5"

Quick Overview

Rabbit anti Human HLA class II DRB5 beta / HLA-DRB5

H00003127-D01P

More Views

  • H00003127-D01P
  • H00003127-D01P

Product Description for HLA class II DRB5 beta / HLA-DRB5

Rabbit anti Human HLA class II DRB5 beta / HLA-DRB5.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for HLA class II DRB5 beta / HLA-DRB5

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DR beta-5, DR2-beta-2, DRB5 beta chain, Dw2, HLA class II histocompatibility antigen, MHC class II antigen DRB5
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q30154
Immunogen:
HLA-DRB5 (NP_002116.2, 1 a.a. ~ 266 a.a) full-length human protein.
AA Sequence:
MVCLKLPGGSYMAKLTVTLMVLSSPLALAGDTRPRFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEY RAVTELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPARTQTLQHHNLLVCSVNGFY PGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAQSESAQSKM LSGVGGFVLGLLFLGAGLFIYFKNQKGHSGLHPTGLVS
GeneID:
3127
Remarks:
Gene Accession: NM_002125
Add. information Rabbit polyclonal antibody raised against a full-length human HLA-DRB5 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3127

Accessory Products

Proteins and/or Positive Controls

Positive controls for HLA class II DRB5 beta / HLA-DRB5 (3 products)

Catalog No. Species Pres. Purity   Source  

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)

HLA-DRB5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HLA overexpression lysate

HLA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn