H00003108-B01P HLA-DMA antibody

See related secondary antibodies

Search for all "HLA-DMA"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human HLA-DMA

H00003108-B01P

Product Description for HLA-DMA

Mouse anti Human HLA-DMA.
Product is tested for Western blot / Immunoblot.

Properties for HLA-DMA

Product Category Primary Antibodies
Quantity 50 µg
Synonyms D6S222E, DMA, HLADM, RING6
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q31604
Immunogen:
HLA-DMA (NP_006111.2, 1 a.a. ~ 261 a.a) full-length human protein.
AA Sequence:
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQN TRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNL FPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLL ENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD
GeneID:
3108
Add. information Mouse polyclonal antibody raised against a full-length human HLA-DMA protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn