
NBP1-69222 HMGA1 antibody

See related secondary antibodies

Search for all "HMGA1"

50 µg / €390.00

Quick Overview

Rabbit anti Human HMGA1


Product Description for HMGA1

Rabbit anti Human HMGA1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HMGA1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms HMG-R, HMGA1A, HMGIY, MGC12816, MGC4242, MGC4854
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to HMGA1 (high mobility group AT-hook 1) The peptide sequence was selected from the N terminal of HMGA1. Peptide sequence MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP.
Background This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 3159

Accessory Products

  • LinkedIn