TA345375 HOXA6 / HOX1B antibody

Rabbit Polyclonal Anti-HOXA6 Antibody

See related secondary antibodies

Search for all "HOXA6 / HOX1B"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXA6 / HOX1B

Product Description for HOXA6 / HOX1B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXA6 / HOX1B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXA6 / HOX1B

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Homeobox protein Hox-A6, Hox-1B
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-HOXA6 antibody: synthetic peptide directed towards the middle region of human HOXA6. Synthetic peptide located within the following region: YLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSE.
Application WB
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters med A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXA6 / HOX1B (5 products)

Catalog No. Species Pres. Purity   Source  

HOXA6 / HOX1B (full length, N-term HIS tag)

HOXA6 / HOX1B Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.


HOXA6 / HOX1B Human Purified
  Abnova Taiwan Corp.


HOXA6 / HOX1B Human Purified
  Abnova Taiwan Corp.


HOXA6 / HOX1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


HOXA6 / HOX1B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXA6 / HOX1B (1 products)

Catalog No. Species Pres. Purity   Source  

HOXA6 Lysate

Western Blot: HOXA6 Lysate [NBL1-11669] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HOXA6
  Novus Biologicals Inc.
  • LinkedIn