TA341777 HOXB1 / HOX2I antibody

Rabbit Polyclonal Anti-Hoxb1 Antibody

See related secondary antibodies

Search for all "HOXB1 / HOX2I"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat HOXB1 / HOX2I

Product Description for HOXB1 / HOX2I

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat HOXB1 / HOX2I.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB1 / HOX2I

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Homeobox protein Hox-B1, Hox-2I
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14653
Immunogen:
The immunogen for anti-Hoxb1 antibody: synthetic peptide directed towards the N terminal of mouse Hoxb1. Synthetic peptide located within the following region: QQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGDGSYFHPSS.
GeneID:
3211
Application WB
Background Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities onThe anterior-posterior axis. Acts onThe anterior body structures.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB1 / HOX2I (9 products)

Catalog No. Species Pres. Purity   Source  

HOXB1 / HOX2I

HOXB1 / HOX2I Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

HOXB1 / HOX2I

HOXB1 / HOX2I Human
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human Purified
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HOXB1 / HOX2I

HOXB1 / HOX2I Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HOXB1 / HOX2I (2 products)

Catalog No. Species Pres. Purity   Source  

HOXB1 293T Cell Transient Overexpression Lysate(Denatured)

HOXB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HOXB1 overexpression lysate

HOXB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn