TA339064 HOXB2 / HOX2H antibody

Rabbit Polyclonal Anti-HOXB2 Antibody

See related secondary antibodies

Search for all "HOXB2 / HOX2H"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB2 / HOX2H

TA339064

More Views

  • TA339064
  • TA339064
  • TA339064
  • TA339064
  • TA339064

Product Description for HOXB2 / HOX2H

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXB2 / HOX2H.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB2 / HOX2H

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Homeobox protein Hox-B2, Hox-2.8, Hox-2H, K8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P14652
Immunogen:
The immunogen for anti-HOXB2 antibody: synthetic peptide directed towards the N terminal of human HOXB2. Synthetic peptide located within the following region: RAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASA.
GeneID:
3212
Application WB
Background This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox D-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn