discontinued

H00003217-M03 HOXB7 / HOX2C antibody

See related secondary antibodies

Search for all "HOXB7 / HOX2C"

Quick Overview

Mouse anti Human HOXB7 / HOX2C 4C6

H00003217-M03

More Views

  • H00003217-M03

Product Description for HOXB7 / HOX2C

Mouse anti Human HOXB7 / HOX2C 4C6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for HOXB7 / HOX2C

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms HHO.C1, Homeobox protein Hox-B7, Hox-2C
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 4C6
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P09629
Immunogen:
HOXB7 (NP_004493, 55 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA*
GeneID:
3217
Remarks:
Gene Accession: NM_004502
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant HOXB7.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3217

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB7 / HOX2C (3 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 / HOX2C

HOXB7 / HOX2C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXB7 / HOX2C (3 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M01) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M02) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 overexpression lysate

HOXB7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn