TA343468 HOXB7 / HOX2C antibody

Rabbit Polyclonal Anti-HOXB7 Antibody

See related secondary antibodies

Search for all "HOXB7 / HOX2C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXB7 / HOX2C

Product Description for HOXB7 / HOX2C

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HOXB7 / HOX2C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXB7 / HOX2C

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms HHO.C1, Homeobox protein Hox-B7, Hox-2C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P09629
Immunogen:
The immunogen for anti-HOXB7 antibody: synthetic peptide directed towards the C terminal of human HOXB7. Synthetic peptide located within the following region: RYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRA.
GeneID:
3217
Application WB
Background HOXB7 is a member of the Antp homeobox family and is a protein with a homeobox D-binding domain. The nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox D-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXB7 / HOX2C (3 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 / HOX2C

HOXB7 / HOX2C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HOXB7 / HOX2C

HOXB7 / HOX2C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for HOXB7 / HOX2C (3 products)

Catalog No. Species Pres. Purity   Source  

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M01) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

HOXB7 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-HOXB7 antibody (H00003217-M02) by Western Blots.
  Abnova Taiwan Corp.

HOXB7 overexpression lysate

HOXB7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn