discontinued

H00003235-M01 HOXD9 / HOX4C antibody

See related secondary antibodies

Search for all "HOXD9 / HOX4C"

Quick Overview

Mouse anti Human, Mouse HOXD9 / HOX4C 2A9

Product Description for HOXD9 / HOX4C

Mouse anti Human, Mouse HOXD9 / HOX4C 2A9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for HOXD9 / HOX4C

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Homeobox protein Hox-D9, Hox-4C, Hox-5.2
Presentation Purified
Reactivity Hu, Ms
Applications E, WB
Clonality Monoclonal
Clone 2A9
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P28356
Immunogen:
HOXD9 (NP_055028, 146 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
RHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQGSSGPEFSCNSFLQEKAAA*
GeneID:
3235
Remarks:
Gene Accession: NM_014213
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant HOXD9.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Mouse
Gene ID 3235

Accessory Products

Proteins and/or Positive Controls

Proteins for HOXD9 / HOX4C (1 products)

Catalog No. Species Pres. Purity   Source  

HOXD9 / HOX4C

HOXD9 / HOX4C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for HOXD9 / HOX4C (1 products)

Catalog No. Species Pres. Purity   Source  

HOXD9 Lysate

Western Blot: HOXD9 Lysate [NBL1-11685] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HOXD9
  Novus Biologicals Inc.
  • LinkedIn