TA343721 HOXD9 / HOX4C antibody

Rabbit Polyclonal Anti-Hoxd9 Antibody

See related secondary antibodies

Search for all "HOXD9 / HOX4C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXD9 / HOX4C

Product Description for HOXD9 / HOX4C

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat HOXD9 / HOX4C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HOXD9 / HOX4C

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Homeobox protein Hox-D9, Hox-4C, Hox-5.2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Hoxd9 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd9. Synthetic peptide located within the following region: MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAAA.
Application WB
Background Hoxd9 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positiol identities on the anterior-posterior axis.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn