discontinued

NBP1-69075 HPS3 antibody

See related secondary antibodies

Search for all "HPS3"

50 µg / €390.00

Quick Overview

Rabbit anti Rat HPS3

NBP1-69075

Product Description for HPS3

Rabbit anti Rat HPS3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HPS3

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q60C80
Immunogen:
Synthetic peptides corresponding to Hps3 (Hermansky-Pudlak syndrome 3 homolog (human)) The peptide sequence was selected from the N terminal of Hps3. Peptide sequence LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND.
GeneID:
3102880
Background The function of Hps3 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 3102880

Accessory Products

  • LinkedIn