discontinued

H00009653-A01 HS2ST1 / 2OST antibody

See related secondary antibodies

Search for all "HS2ST1 / 2OST"

Quick Overview

Mouse anti Human HS2ST1 / 2OST

Product Description for HS2ST1 / 2OST

Mouse anti Human HS2ST1 / 2OST.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for HS2ST1 / 2OST

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms 2-O-sulfotransferase, HS2ST, Heparan sulfate 2-O-sulfotransferase 1, KIAA0448
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7LGA3
Immunogen:
HS2ST1 (NP_036394, 130 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
AA Sequence:
SWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEG GSDCAPEKLWLQIPFFCGHSSECW*
GeneID:
9653
Remarks:
Gene Accession: NM_012262
Add. information Mouse polyclonal antibody raised against a partial recombinant HS2ST1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Ti
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9653

Accessory Products

Proteins and/or Positive Controls

Proteins for HS2ST1 / 2OST (6 products)

Catalog No. Species Pres. Purity   Source  

HS2ST1 / 2OST

HS2ST1 / 2OST Human
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human Purified
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human Purified
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human
  Abnova Taiwan Corp.

Positive controls for HS2ST1 / 2OST (3 products)

Catalog No. Species Pres. Purity   Source  

Heparan sulfate 2-O-sulfotransferase 1 Lysate

Western Blot: Heparan sulfate 2-O-sulfotransferase 1 Lysate [NBL1-11712] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HS2ST1.
  Novus Biologicals Inc.

HS2ST1 293T Cell Transient Overexpression Lysate(Denatured)

HS2ST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HS2ST1 overexpression lysate

HS2ST1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn