discontinued

H00009653-B01P HS2ST1 / 2OST antibody

See related secondary antibodies

Search for all "HS2ST1 / 2OST"

Quick Overview

Mouse anti Human HS2ST1 / 2OST

H00009653-B01P

More Views

  • H00009653-B01P

Product Description for HS2ST1 / 2OST

Mouse anti Human HS2ST1 / 2OST.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for HS2ST1 / 2OST

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 2-O-sulfotransferase, HS2ST, Heparan sulfate 2-O-sulfotransferase 1, KIAA0448
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7LGA3
Immunogen:
HS2ST1 (AAH25990.1, 1 a.a. ~ 229 a.a) full-length human protein.
AA Sequence:
MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVI IYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYHGHVSYLDFAKFG VKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSEC W
GeneID:
9653
Remarks:
Gene Accession: BC025990.1
Add. information Mouse polyclonal antibody raised against a full-length human HS2ST1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9653

Accessory Products

Proteins and/or Positive Controls

Proteins for HS2ST1 / 2OST (6 products)

Catalog No. Species Pres. Purity   Source  

HS2ST1 / 2OST

HS2ST1 / 2OST Human
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human Purified
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human Purified
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HS2ST1 / 2OST

HS2ST1 / 2OST Human
  Abnova Taiwan Corp.

Positive controls for HS2ST1 / 2OST (3 products)

Catalog No. Species Pres. Purity   Source  

Heparan sulfate 2-O-sulfotransferase 1 Lysate

Western Blot: Heparan sulfate 2-O-sulfotransferase 1 Lysate [NBL1-11712] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HS2ST1.
  Novus Biologicals Inc.

HS2ST1 293T Cell Transient Overexpression Lysate(Denatured)

HS2ST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HS2ST1 overexpression lysate

HS2ST1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn