
TA339231 HSU79252 antibody

Rabbit Polyclonal Anti-HSU79252

See related secondary antibodies

Search for all "HSU79252"

Quick Overview

Rabbit anti Human HSU79252

Product Description for HSU79252

Rabbit anti Human HSU79252.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSU79252

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

The immunogen for anti-HSU79252 antibody: synthetic peptide directed towards the C terminal of human HSU79252. Synthetic peptide located within the following region: HLVVFKFLVPEAKSTTCLLVTCLPAVVVDVLAGRFGISHQSFCTVLVSSI.
Application WB
Background The exact functions of HSU79252 remain unknown.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn