NBP1-70763 HT011 antibody

See related secondary antibodies

Search for all "HT011"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HT011

Product Description for HT011

Rabbit anti Human HT011.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HT011

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FAM45B(family with sequence similarity 45, member A pseudogene) The peptide sequence was selected from the middle region of FAM45B. Peptide sequence FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA.
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 5585500

Accessory Products

  • LinkedIn