
NBP1-70763 HT011 antibody

See related secondary antibodies

Search for all "HT011"

Quick Overview

Rabbit anti Human HT011

Product Description for HT011

Rabbit anti Human HT011.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HT011

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to FAM45B(family with sequence similarity 45, member A pseudogene) The peptide sequence was selected from the middle region of FAM45B. Peptide sequence FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA.
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 5585500

Accessory Products

  • LinkedIn