discontinued

H00027429-M03 HTRA2 / PRSS25 antibody

See related secondary antibodies

Search for all "HTRA2 / PRSS25"

Quick Overview

Mouse anti Human HTRA2 / PRSS25 3G5

H00027429-M03

More Views

  • H00027429-M03
  • H00027429-M03

Product Description for HTRA2 / PRSS25

Mouse anti Human HTRA2 / PRSS25 3G5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for HTRA2 / PRSS25

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms High temperature requirement protein A2, OMI, Omi stress-regulated endoprotease, Serine protease 25, Serine proteinase OMI, mitochondrial Serine protease HTRA2
Presentation Purified
Reactivity Hu
Applications E, ICC/IF, WB
Clonality Monoclonal
Clone 3G5
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O43464
Immunogen:
HTRA2 (AAH00096, 359 a.a. ~ 458 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQ SQLAVQIRRGRETLTLYVTPEVTE
GeneID:
27429
Remarks:
Gene Accession: BC000096
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant HTRA2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IF,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 27429

Accessory Products

Proteins and/or Positive Controls

Proteins for HTRA2 / PRSS25 (9 products)

Catalog No. Species Pres. Purity   Source  

HTRA2 / PRSS25

HTRA2 / PRSS25 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

HTRA2 / PRSS25

HTRA2 / PRSS25 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

HTRA2 / PRSS25

HTRA2 / PRSS25 Human Purified >90.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  Acris Antibodies GmbH

HTRA2 / PRSS25 (134-458, His-tag)

HtrA2/Omi: 15% SDS-PAGE Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / €230.00
  Acris Antibodies GmbH

HTRA2 / PRSS25 (134-458, His-tag)

HtrA2/Omi: 15% SDS-PAGE Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / €540.00
  Acris Antibodies GmbH

HTRA2 / PRSS25

HTRA2 / PRSS25 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HTRA2 / PRSS25

HTRA2 / PRSS25 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HTRA2 / PRSS25

HTRA2 / PRSS25 Human
  Abnova Taiwan Corp.

HTRA2 / PRSS25

SDS-Page: HtrA2 Protein [NBC1-18522] - HtrA2/Omi, 36kDa (334aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for HTRA2 / PRSS25 (2 products)

Catalog No. Species Pres. Purity   Source  

HTRA2 overexpression lysate

HTRA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

HTRA2 overexpression lysate

HTRA2 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn