discontinued

NBP1-70764 HUGT1 antibody

See related secondary antibodies

Search for all "HUGT1"

50 µg / €440.00

Quick Overview

Rabbit anti Human HUGT1

Product Description for HUGT1

Rabbit anti Human HUGT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HUGT1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8KAK1
Immunogen:
Synthetic peptides corresponding to UGCGL1 (UDP-glucose glycoprotein glucosyltransferase 1) The peptide sequence was selected from the middle region of UGCGL1. Peptide sequence AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE.
Background UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn