NBP1-70764 HUGT1 antibody

See related secondary antibodies

Search for all "HUGT1"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HUGT1

Product Description for HUGT1

Rabbit anti Human HUGT1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for HUGT1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to UGCGL1 (UDP-glucose glycoprotein glucosyltransferase 1) The peptide sequence was selected from the middle region of UGCGL1. Peptide sequence AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE.
Background UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn