TA341911 ICMT / PCCMT antibody

Rabbit Polyclonal Anti-ICMT Antibody

See related secondary antibodies

Search for all "ICMT / PCCMT"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ICMT / PCCMT

Product Description for ICMT / PCCMT

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast ICMT / PCCMT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ICMT / PCCMT

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Isoprenylcysteine carboxylmethyltransferase, PPMT, Prenylated protein carboxyl methyltransferase, Prenylcysteine carboxyl methyltransferase, Protein-S-isoprenylcysteine O-methyltransferase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ICMT antibody: synthetic peptide directed towards the middle region of human ICMT. Synthetic peptide located within the following region: GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPI.
Application WB
Background This gene encodesThe third of three enzymes that posttranslatiolly modify isoprenylated C-termil cysteine residues in certain proteins and target those proteins toThe cell membrane.This enzyme localizes toThe endoplasmic reticulum. Altertive splicing may result in other transcript variants, butThe biological validity of those transcripts has not been determined. [provided by RefSeq, Jul 2008].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ICMT / PCCMT (6 products)

Catalog No. Species Pres. Purity   Source  


  Abnova Taiwan Corp.


ICMT / PCCMT Human Purified
  Abnova Taiwan Corp.


ICMT / PCCMT Human Purified
  Abnova Taiwan Corp.


ICMT / PCCMT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ICMT / PCCMT Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


ICMT / PCCMT Human Purified
  Novus Biologicals Inc.
  • LinkedIn