discontinued

H00003397-M11 ID1 / BHLHB24 antibody

See related secondary antibodies

Search for all "ID1 / BHLHB24"

Quick Overview

Mouse anti Human ID1 / BHLHB24 2C7

Product Description for ID1 / BHLHB24

Mouse anti Human ID1 / BHLHB24 2C7.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ID1 / BHLHB24

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Class B basic helix-loop-helix protein 24, DNA-binding protein inhibitor ID-1, Inhibitor of DNA binding 1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2C7
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P41134
Immunogen:
ID1 (AAH00613, 1 a.a. ~ 156 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRL KELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRI LCR*
GeneID:
3397
Remarks:
Gene Accession: BC000613
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant ID1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3397

Accessory Products

Proteins and/or Positive Controls

Proteins for ID1 / BHLHB24 (5 products)

Catalog No. Species Pres. Purity   Source  

ID1 / BHLHB24 (transcript variant 1)

ID1 / BHLHB24 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

ID1 / BHLHB24 (1-155, His-tag)

ID1 / BHLHB24 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

ID1 / BHLHB24 (1-155, His-tag)

ID1 / BHLHB24 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH

ID1 / BHLHB24

ID1 / BHLHB24 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ID1 / BHLHB24

ID1 / BHLHB24 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ID1 / BHLHB24 (5 products)

Catalog No. Species Pres. Purity   Source  

ID1 293T Cell Transient Overexpression Lysate(Denatured)

ID1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Id1 Lysate

Western Blot: Id1 Lysate [NBL1-11813] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ID1
  Novus Biologicals Inc.

ID1 overexpression lysate

ID1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ID1 overexpression lysate

ID1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ID1 overexpression lysate

ID1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn