ARP64734_P050 IDO2 / INDOL1 (C-term) antibody

See related secondary antibodies

Search for all "IDO2 / INDOL1"

50 µg / €350.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IDO2 / INDOL1

ARP64734_P050

More Views

  • ARP64734_P050

Product Description for IDO2 / INDOL1

Rabbit anti Human IDO2 / INDOL1.
Properties: (C-term)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for IDO2 / INDOL1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 47 kDa (420 amino acids)
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer AVIVA Systems Biology

Datasheet Extract

Immunogen
Swiss Prot Num:
F5H5G0
Immunogen:
Synthetic peptide directed towards the C-terminal region of Human IDO2
AA Sequence:
LITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILH
GeneID:
169355
Property C-term
Application Western Blot.
Background Along with the enzymes encoded by the INDO and TDO2 genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway.
Format
State:
Lyophilized
Aff - Purified
Reconstitution:
Add 50 ul of distilled water. Final anti-IDO2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Species Reactivity
Species reactivity (tested):
Human.

Accessory Products

  • LinkedIn