NBP1-57838 IFI44L antibody

See related secondary antibodies

Search for all "IFI44L"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human IFI44L

Product Description for IFI44L

Rabbit anti Human IFI44L.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for IFI44L

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A5UGS9
Immunogen:
Synthetic peptides corresponding to IFI44L(interferon-induced protein 44-like) The peptide sequence was selected from the N terminal of IFI44L. Peptide sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT.
GeneID:
5226387
Background The function remains known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Purified
Gene ID 5226387

Accessory Products

  • LinkedIn