discontinued

H00003449-B01P IFNA16 / Interferon alpha-16 antibody

See related secondary antibodies

Search for all "IFNA16 / Interferon alpha-16"

Quick Overview

Mouse anti Human IFNA16 / Interferon alpha-16

Product Description for IFNA16 / Interferon alpha-16

Mouse anti Human IFNA16 / Interferon alpha-16.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IFNA16 / Interferon alpha-16

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IFN-alpha-16, Interferon alpha-WA
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P05015
Immunogen:
IFNA16 (NP_002164, 1 a.a. ~ 189 a.a) full-length human protein.
AA Sequence:
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQA ISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITL YLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD
GeneID:
3449
Remarks:
Gene Accession: NM_002173
Add. information Mouse polyclonal antibody raised against a full-length human IFNA16 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3449

Accessory Products

Proteins and/or Positive Controls

Proteins for IFNA16 / Interferon alpha-16 (3 products)

Catalog No. Species Pres. Purity   Source  

IFNA16 / Interferon alpha-16

IFNA16 / Interferon alpha-16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA16 / Interferon alpha-16

IFNA16 / Interferon alpha-16 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA16 / Interferon alpha-16

IFNA16 / Interferon alpha-16 Human > 95 % E. coli
1 x 10⁵ U / €330.00
  PBL Assay Science

Positive controls for IFNA16 / Interferon alpha-16 (2 products)

Catalog No. Species Pres. Purity   Source  

IFNA16 293T Cell Transient Overexpression Lysate(Denatured)

IFNA16 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IFNA16 overexpression lysate

IFNA16 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn