discontinued

H00003442-B01P IFNA5 / Interferon alpha-5 antibody

See related secondary antibodies

Search for all "IFNA5 / Interferon alpha-5"

Quick Overview

Mouse anti Human IFNA5 / Interferon alpha-5

Product Description for IFNA5 / Interferon alpha-5

Mouse anti Human IFNA5 / Interferon alpha-5.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IFNA5 / Interferon alpha-5

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IFN-alpha-5, Interferon alpha-61, Interferon alpha-G, LeIF G
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P01569
Immunogen:
IFNA5 (NP_002160.1, 1 a.a. ~ 189 a.a) full-length human protein.
AA Sequence:
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQA ISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITL YLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
GeneID:
3442
Remarks:
Gene Accession: NM_002169.1
Add. information Mouse polyclonal antibody raised against a full-length human IFNA5 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3442

Accessory Products

Proteins and/or Positive Controls

Proteins for IFNA5 / Interferon alpha-5 (6 products)

Catalog No. Species Pres. Purity   Source  

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human > 95 % E. coli
1 x 10⁵ U / €330.00
  PBL Assay Science

Positive controls for IFNA5 / Interferon alpha-5 (2 products)

Catalog No. Species Pres. Purity   Source  

IFNA5 293T Cell Transient Overexpression Lysate(Denatured)

IFNA5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IFNA5 Lysate

Western Blot: IFNA5 Lysate [NBL1-11844] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IFNA5
  Novus Biologicals Inc.
  • LinkedIn