TA335047 IFNA5 / Interferon alpha-5 antibody

Rabbit Polyclonal Anti-IFNA5 Antibody

See related secondary antibodies

Search for all "IFNA5 / Interferon alpha-5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rat IFNA5 / Interferon alpha-5

Product Description for IFNA5 / Interferon alpha-5

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rat IFNA5 / Interferon alpha-5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IFNA5 / Interferon alpha-5

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms IFN-alpha-5, Interferon alpha-61, Interferon alpha-G, LeIF G
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-IFNA5 antibody: synthetic peptide directed towards the middle region of human IFNA5. Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY.
Application WB
Background Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for IFNA5 / Interferon alpha-5 (6 products)

Catalog No. Species Pres. Purity   Source  

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNA5 / Interferon alpha-5

IFNA5 / Interferon alpha-5 Human > 95 % E. coli
1 x 10⁵ U / €320.00
  PBL Assay Science

Positive controls for IFNA5 / Interferon alpha-5 (2 products)

Catalog No. Species Pres. Purity   Source  

IFNA5 293T Cell Transient Overexpression Lysate(Denatured)

IFNA5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IFNA5 Lysate

Western Blot: IFNA5 Lysate [NBL1-11844] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IFNA5
  Novus Biologicals Inc.
  • LinkedIn