discontinued

H00003454-B01P IFNAR1 antibody

See related secondary antibodies

Search for all "IFNAR1"

Quick Overview

Mouse anti Human IFNAR1

Product Description for IFNAR1

Mouse anti Human IFNAR1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IFNAR1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CRF2-1, Cytokine receptor class-II member 1, Cytokine receptor family 2 member 1, IFN-R-1, IFN-alpha Receptor alpha, IFN-alpha/beta receptor 1, Interferon-alpha/beta receptor alpha chain, Type I interferon receptor 1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P17181
Immunogen:
IFNAR1 (NP_000620, 1 a.a. ~ 557 a.a) full-length human protein.
AA Sequence:
MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKL SGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGTKD SVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENE LPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYL LRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNA ERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYA AKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTS QDSGNYSNEDESESKTSEELQQDFV
GeneID:
3454
Remarks:
Gene Accession: NM_000629
Add. information Mouse polyclonal antibody raised against a full-length human IFNAR1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 3454

Accessory Products

Proteins and/or Positive Controls

Proteins for IFNAR1 (5 products)

Catalog No. Species Pres. Purity   Source  

IFNAR1

IFNAR1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €139.00
  OriGene Technologies, Inc.

IFNAR1

IFNAR1 Human Purified
  Abnova Taiwan Corp.

IFNAR1

IFNAR1 Human Purified
  Abnova Taiwan Corp.

IFNAR1

IFNAR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

IFNAR1

IFNAR1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for IFNAR1 (1 products)

Catalog No. Species Pres. Purity   Source  

IFNAR1 293T Cell Transient Overexpression Lysate(Denatured)

IFNAR1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn