TA341669 IFT140 antibody

Rabbit Polyclonal Anti-IFT140 Antibody

See related secondary antibodies

Search for all "IFT140"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat IFT140


More Views

  • TA341669

Product Description for IFT140

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat IFT140.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IFT140

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Intraflagellar transport protein 140 homolog, KIAA0590, WD and tetratricopeptide repeats protein 2, WDTC2
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-IFT140 antibody: synthetic peptide directed towards the N terminal of human IFT140. Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF.
Application WB
Background This gene encodes one ofThe subunits ofThe intraflagellar transport (IFT) complex A. Intraflagellar transport is involved inThe genesis, resorption and sigling of primary cilia.The primary cilium is a microtubule-based sensory organelle atThe surface of most quiescent mammalian cells, that receives sigls from its environment, such asThe flow of fluid, light or odors, and transduces those sigls toThe nucleus. Loss ofThe corresponding protein in mouse results in rel cystic disease. [provided by RefSeq, Jun 2012].
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn