H00112752-B01P IFT43 antibody

See related secondary antibodies

Search for all "IFT43"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human IFT43

H00112752-B01P

Product Description for IFT43

Mouse anti Human IFT43.
Product is tested for Western blot / Immunoblot.

Properties for IFT43

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms C14orf179, CED3
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96FT9
Immunogen:
IFT43 (NP_443105.1, 1 a.a. ~ 213 a.a) full-length human protein.
AA Sequence:
MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKASNGTQT GKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDLDNDLMKYSAIQT LDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQARHT
GeneID:
112752
Add. information Mouse polyclonal antibody raised against a full-length human IFT43 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for IFT43 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 (transcript variant 1)

Chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for IFT43 (3 products)

Catalog No. Species Pres. Purity   Source  

C14orf179 Lysate

Western Blot: C14orf179 Lysate [NBL1-08186] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C14orf179 Protein
0.1 mg / €400.00
  Novus Biologicals Inc.

IFT43 overexpression lysate

IFT43 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

IFT43 overexpression lysate

IFT43 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn