discontinued

H00028981-B01P IFT81 / CDV1 antibody

See related secondary antibodies

Search for all "IFT81 / CDV1"

Quick Overview

Mouse anti Human IFT81 / CDV1

Product Description for IFT81 / CDV1

Mouse anti Human IFT81 / CDV1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for IFT81 / CDV1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CDV-1, Carnitine deficiency-associated protein expressed in ventricle 1, Intraflagellar transport protein 81 homolog
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WYA0
Immunogen:
IFT81 (NP_054774.2, 1 a.a. ~ 676 a.a) full-length human protein.
AA Sequence:
MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQLVDIREEMPEQTAKRMLSLLGILKYKP SGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEAFK TLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQNHQWMLKIARQLRVEKEREEYLAQQKQE QKNQLFHAVQRLQRVQNQLKSMRQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVSEPAM GHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAEELQEAKEKLASLEREASVKR NQTREFDGTEVLKGDEFKRYVNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTMEEKKGIS GYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEKKSALASVIKELRQLRQKYQELTQECDEKKSQY DSCAAGLESNRSKLEQEVRRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAIREQYTKNT AEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSQTSIGQVIQEGGEDRLIL
GeneID:
28981
Remarks:
Gene Accession: NM_014055
Add. information Mouse polyclonal antibody raised against a full-length human IFT81 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 28981

Accessory Products

Proteins and/or Positive Controls

Proteins for IFT81 / CDV1 (2 products)

Catalog No. Species Pres. Purity   Source  

IFT81 / CDV1

IFT81 / CDV1 Human Purified
  Abnova Taiwan Corp.

IFT81 / CDV1

IFT81 / CDV1 Human Purified
  Abnova Taiwan Corp.

Positive controls for IFT81 / CDV1 (3 products)

Catalog No. Species Pres. Purity   Source  

IFT81 293T Cell Transient Overexpression Lysate(Denatured)

IFT81 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IFT81 Lysate

Western Blot: IFT81 Lysate [NBL1-11862] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IFT81
  Novus Biologicals Inc.

IFT81 overexpression lysate

IFT81 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn